نوع مقاله : مقاله پژوهشی

نویسندگان

1 استادیار گروه مهندسی ژنتیک و بیولوژی، پژوهشکده ژنتیک و زیست فناوری کشاورزی طبرستان، دانشگاه علوم کشاورزی و منابع طبیعی ساری.

2 دانشجوی دکتری اصلاح نباتات، دانشگاه علوم کشاورزی و منابع طبیعی ساری

چکیده

خانواده ژنی DREB یک خانواده بزرگ از عوامل رونویسی است که نقش‌های مهمی در تنظیم رشد گیاه و پاسخ به تنش‌های محیطی خارجی ایفا می‌کنند. با توجه به تعیین‌‌توالی ژنوم گیاه هالوفیت آلوروپوس لیتورالیس (Aeluropus littoralis) فرصتی برای آنالیز گسترده ژنومی ژن‌های خانواده ژنی DREB، فراهم شد. در مجموع، 16 ژن غیر تکراری رمزکننده DREB در ژنوم آلوروپوس شناسایی شد. در این پژوهش، ساختارهای ژنی، روابط فیلوژنتیکی، ترکیب موتیف‌ها و الگوهای بیان ژن‌های DREB تحت تنش شوری و بازیابی، مورد تجزیه و تحلیل قرار گرفتند. ساختار فیلوژنی نشان داد که ژن‌های خانوادة ژنیDREB آلوروپوس بر مبنای همولوژی با گیاه مدل آرابیدوپسیس تالیانا به 5 گروه A1، A2، A4، A5 و A6 تقسیم‌بندی شدند. آنالیز ساختارهای ژنی و ترکیب موتیف‌ها نشان داد که این ژن‌ها در هر گروه از حفاظت‌شدگی بالایی برخوردار بوده که احتمالاً حاکی از کارکردهای مشابه اعضای هر گروه می‌باشد. بر اساس داده‌های تعیین‌توالی RNA ، ژن‌های AlDREB6.3 و AlDREB6.2، ببیشترین بیان را در شرایط تنش شوری در بافت ریشه به نمایش گذاشتند. بیشترین کاهش بیان نیز در ژن‌های AlDREB6.4 و AlDREB6.3، در شرایط بازیابی در بافت برگی مشاهده شد. نتایج این تحقیق می‌تواند پایه‌ای برای تجزیه و تحلیل کارکردی ژن‌هایDREB آلوروپوس برای درک نقش‌های زیست‌شناختی آن‌ها فراهم آورد.

کلیدواژه‌ها

عنوان مقاله [English]

Identification, classification and expression analysis of DREB transcription factor gene family in Aeluropus littoralis under salinity stress

نویسندگان [English]

  • seyedhamidreza Hashemi-petroudi 1
  • Samira Mohammadi 2

1 Genetic engineering and biology department, Genetic and Agricultural Biotechnology Institute of Tabarestan (GABIT), Sari Agricultural Sciences and Natural Resources University (SANRU) Sari, Iran, P. O. Box 578

2 Ph.D. Student in Plant Breeding, Sari Agricultural Sciences and Natural Resources University (SANRU)

چکیده [English]

DREB gene family is one large family of transcription factors that plays an important role in regulating plant growth and the response to external environmental stresses. Due to the sequencing of the Aeluropus littoralis halophyte plant genome has provided an excellent opportunity for genome-wide analysis of genes belonging to DREB gene family. In total, 16 non-redundant DREB-encoding genes were identified from the genomic sequences of A. littoralis. In this research, gene structures, phylogenetic relationships, motif compositions and expression profiles of DREB genes under salt stress and recovery conditions were analyzed. The phylogenic construction suggests that the AlDREB gene family was classified into five groups (A1, A2, A4, A5 and A6) in A. littoralis. Gene structure and motif composition revealed that these genes were conservative in each group, suggesting that members of the same group may also have conserved functions. Based on RNA-seq data, AlDREB6.3 and AlDREB6.2 genes were expressed more in root tissue under salinity stress. The least expression level was observed in AlDREB6.4 and AlDREB6.3 genes in leaf tissue under recovery conditions. Result of this study can be applied as a foundation for functional analyses to unravel the biological roles of Aeloropus’ DREB genes.

کلیدواژه‌ها [English]

  • Aeluropus littoralis
  • DREB transcription factor
  • Gene expression
  • Phylogenetic relationships
  • salinity stress

شناسایی، طبقه‌بندی و آنالیز بیان خانواده ژنی عوامل رونویسی DREB در گیاه آلوروپوس لیتورالیس (Aeluropus littoralis) تحت تنش شوری

سیدحمیدرضا هاشمی‌پطرودی* و سمیرا محمدی

ایران، ساری، دانشگاه علوم کشاورزی و منابع طبیعی ساری، پژوهشکده ژنتیک و زیست‌فناوری کشاورزی طبرستان، گروه مهندسی ژنتیک و بیولوژی

تاریخ دریافت: 11/5/98                تاریخ پذیرش: 17/9/98

چکیده

خانواده ژنی DREB یک خانواده بزرگ از عوامل رونویسی است که نقش‌های مهمی در تنظیم رشد گیاه و پاسخ به تنش‌های محیطی خارجی ایفا می‌کنند. باتوجه به تعیین ‌‌توالی ژنوم گیاه هالوفیت آلوروپوس لیتورالیس (Aeluropus littoralis) فرصتی برای آنالیز گسترده ژنومی ژن‌های خانواده ژنی DREB، فراهم شد. در مجموع، 16 ژن غیرتکراری رمزکننده DREB در ژنوم آلوروپوس شناسایی شد. در این پژوهش، ساختارهای ژنی، روابط فیلوژنتیکی، ترکیب موتیف‌ها و الگوهای بیان ژن‌های DREB تحت تنش شوری و بازیابی، مورد تجزیه و تحلیل قرارگرفتند. ساختار فیلوژنی نشان داد که ژن‌های خانوادة ژنیDREB  آلوروپوس بر مبنای همولوژی با گیاه مدل آرابیدوپسیس تالیانا به 5 گروه A1، A2، A4، A5 و A6 تقسیم‌بندی شدند. آنالیز ساختارهای ژنی و ترکیب موتیف‌ها نشان داد که این ژن‌ها در هر گروه از حفاظت‌شدگی بالایی برخوردار بوده که احتمالاً حاکی از کارکردهای مشابه اعضای هر گروه می‌باشد. براساس داده‌های تعیین‌توالی RNA، ژن‌های AlDREB6.3 و AlDREB6.2، ببیشترین بیان را در شرایط تنش شوری در بافت ریشه به نمایش گذاشتند. بیشترین کاهش بیان نیز در ژن‌های AlDREB6.4 و AlDREB6.3، در شرایط بازیابی در بافت برگی مشاهده شد. نتایج این تحقیق می‌تواند پایه‌ای برای تجزیه و تحلیل کارکردی ژن‌هایDREB  آلوروپوس برای درک نقش‌های زیست‌شناختی آن‌ها فراهم آورد.

واژه‌های کلیدی: آلوروپوس لیتورالیس، بیان ژن، تنش شوری، روابط فیلوژنتیکی، عوامل رونویسیDREB  

* نویسنده مسئول، تلفن:    01133687747 ، پست الکترونیکی: [email protected]

مقدمه

 

تنش‌های ‌محیطی مانند شوری اثرات نامطلوبی بر رشد و نمو گیاهان دارند. گیاهان در طول تکامل، پاسخ‌های فیزیولوژیکی و متابولیکی متنوعی را جهت دفاع در برابر شرایط نامطلوب محیطی، توسعه داده‌اند. بطور کلی، تنش‌ها موجب القای بیان ژن‌های خاصی می‌شوند که محصولات این ژن‌ها نقش تعیین‌کننده‌ای در مکانیسم دفاعی در برابر تنش‌های گیاهی برعهده دارند (1). عوامل رونویسی می‌توانند مجموعه‌ای از ژن‌های تحت کنترل خود را از طریق اتصال اختصاصی به عناصر تنظیمی سیس موجود در راه‌انداز ژن‌های هدف، تنظیم کنند. محصولات این ژن‌ها بعنوان پروتئین‌های تنظیم‌کننده عمل می‌کنند و در نتیجه باعث افزایش تحمل گیاه در برابر تنش می‌شوند. عوامل رونویسی پاسخ‌دهنده به دهیدراسیون (DREB = Dehydration-responsive element-binding protein)، نقش حیاتی در تنظیم رشد گیاه و پاسخ به تنش‌های محیطی خارجی ایفا می‌کنند (5).

خانواده AP2/ERF (APETALA2/ethylene response factor)، یکی از بزرگ‌ترین گروه‌های عوامل رونویسی در گیاهان می‌باشد که با حضور دمین اتصال به DNA نوع AP2/ERF مشخص‌ می‌شوند. این دمین متشکل از 60 تا 70 اسیدآمینه می‌باشند که از درجه حفاظت‌شدگی بالایی برخوردارند (61). عوامل رونویسی DREB، یک زیرگروه بزرگ متعلق به خانواده AP2/ERF است که نقش مهمی در بیان ژن‌های پاسخ‌دهنده به تنش در مسیر مستقل از ABA ایفا می‌کنند (56). در ناحیه راه‌انداز بسیاری از ژن‌های پاسخ‌دهنده به تنش غیرزیستی (مانند خشکی، شوری، سرما و گرما)، عناصر تنظیمی سیس به‌نام DRE/CRT قرار دارند. موتیف 5ʹ-A/GCCGAC-3ʹ هسته توالی DRE می‌باشد که در ناحیه راه‌انداز این ژن‌ها از درجه حفاظت‌شدگی بالایی برخوردار است. عوامل رونویسی DREB با اتصال به ناحیه DRE/CRT، بیان ژن‌های پاسخ‌دهنده به تنش غیرزیستی را تنظیم می‌کنند (52 و 63). عوامل رونویسی DREB در آرابیدوپسیس، بر اساس مشخصات ساختاری به 6 زیرگروه A-1 تا A-6 تقسیم شدند (52).

این عوامل رونویسی بطور کلی در تحمل گیاه در برابر تنش­های غیرزیستی مانند انجماد (28)، خشکی (25)، گرما (48)، شوری (25) و اسمزی (13) نقش دارند. بعنوان مثال می‌توان به بیش‌بیان (Overexpression) ژن DREB1A/CBF3 در گیاه آرابیدوپسیس اشاره نمود که به‌ افزایش قابل توجه تحمل گیاه در برابر تنش‌های خشکی، انجماد و شوری بالا منجر شد (31و 40). بیش‌بیان ژن DREB2A در گیاه آرابیدوپسیس تالیانا نیز موجب القاء بیان ژن‌های پاسخگو به تنش خشکی و گرما شده که با افزایش تحمل به تنش‌های خشکی، گرما و شوری بالا همراه بود (53). لازم بذکر است فعالیت و میزان بیان ژن DREB2A تحت تنش‌های خشکی و گرما، بشدت تحت تأثیر تغییرات بعد از رونویسی (50) و عناصر تنظیمی سیس موجود در ناحیه پروموتری (32) کنترل می‌شود.

در گیاهان، گروه ژنی DREB بصورت خانواده ژنی و از چندین عضو برخوردار می‌باشد. گرچه وجه تسمیه این خانواده بدلیل نقش آنها در تنش هیدراسیون بوده ولی تاکنون کارکردهای متنوع دیگری نیز برای اعضای این خانواده ژنی شناسایی شده است. بعنوان مثال، ژن DREB1D/CBF4 در تحمل گیاه به تنش خشکی نقش دارد، در حالی‌که همولوگ آن ژن DREB1A/CBF3 در پاسخ به تنش سرما عمل می‌کند (18). مشخص شده است که ژن DREB1C/CBF2 بعنوان تنطیم‌کننده منفی، با کنترل بیان ژن‌های DREB1A/CBF3 و DREB1B/CBF1، پاسخ گیاه به تنش سرما را بشدت کنترل می‌کند. گزارش شده است که DREB2C در تحمل به گرما به جای تحمل به خشکی نقش دارد (36). تنوع عملکردی ژن‌های مختلف DREB علی‌رغم همولوژی بالای توالی آنها، بررسی عملکردی و مولکولی اعضای این خانوادة ژنی را جهت درک مکانیسم‌های تنظیمی حاکم در بیان این ژن‌ها اجتناب‌ناپذیر می‌نماید.

در ذرت، بررسی دو ژن DREB (ZmDREB1A و ZmDREB2A) بترتیب متعلق به زیرگروه‌های DREB1 و DREB2 نشان داد که این ژن‌ها در پاسخ به تنش خشکی بیشتر بیان می‌شوند (48و 49). مشخص شد که به ‌غیر از ژن DREB2A آرابیدوپسیس، بیان ژن ZmDREB2A در پاسخ به تنش غیرزیستی از طریق یک مکانیسم پیرایش متناوب (Alternative splicing) تنظیم شده، که پروتئین بیان شده بطور مستقیم بیان ژن پایین‌دست را فعال می‌نماید (48). یافته‌های مشابه در برنج، گندم و جو، حاکی از وجود مکانیسمی است که به‌دقت فعالیت ژن‌های فاکتور رونویسی القاءشونده تحت تنش را تنطیم می‌کند و نشان می‌دهد که این مکانیسم مولکولی در گیاهان تک‌لپه و دولپه متفاوت است (8، 45 و 62). این مشاهدات تأکیدی بر اهمیت شناسایی ژن‌های خانواده DREB برای درک مکانیسم‌های انتقال سیگنال برای بهبود به تنش در گیاهان است.

باتوجه به تعیین‌‌توالی ژنوم گیاه هالوفیت آلوروپوس لیتورالیس (Aeluropus littoralis) در پژوهشکده ژنتیک و زیست‌فناوری طبرستان (منتشر نشده)، فرصتی برای تجزیه و تحلیل و شناخت ژن‌های خانوادة DREB در یک گونه متحمل به تنش از خانواده گندمیان، فراهم شد. گیاه آلوروپوس لیتورالیس گیاهی است تک‌لپه و C4که می‌تواند سطوح بالای شوری (‌بطور معمول کلرید سدیم) را تا بیش از 600 میلی‏مولار تحمل کند و بیشتر در سواحل دریاها و دریاچه‌های شور، کنار جاده و چمنزارهای رودخانه‌ای می‌رویند (2). این گیاه، علاوه‌بر مقاومت به شوری، بعنوان گیاهی مقاوم به خشکی و گرما نیز محسوب می‌شود (16، 24، 30و 65). با اشاره به اهمیت آلوروپوس لیتورالیس بعنوان یک منبع ژنتیکی غنی جهت شناسایی ژن‌های جدید مرتبط با تحمل به شوری، خشکی و گرما برای اصلاح گیاهان زراعی (9، 15، 20، 21، 22 و 23) و همچنین نقش ژن‌های DREB در مقاومت گیاهان نسبت به تنش‌ها، این بررسی بعنوان اولین مطالعه کارکردی ژن‌های DREB در این گیاه صورت گرفت. در این مطالعه، برای تعیین رابطه ساختار-عملکرد ژن‌های خانواده DREB در این گیاه، بررسی گسترده ژنومی این ژن‌ها انجام شد و روابط فیلوژنتیکی ژن‌های DREB1 و DREB2 در آلوروپوس، آرابیدوپسیس، برنج و ذرت نیز مدنظر قرارگرفت. در نهایت، برای درک بیشتر کارکرد این ژن‌ها، الگوی بیان آن‌ها در دو بافت برگ و ریشه و پاسخ‌های آن‌ها در شرایط تنش شوری و بازیابی، مورد بررسی قرار گرفت.

مواد و روشها

شناسایی اعضای خانواده ژنی DREB در آلوروپوس لیتورالیس: دراین مطالعه جهت شناسایی اعضای خانواده ژنی DREB در آلوروپوس لیتورالیس، ابتدا توالی‌های پروتئینی ژن‌های خانواده AP2/ERF برنج و آرابیدوپسیس، بترتیب از پایگاه‌های داده RGAP (http://rice.plantbiology.msu.edu/) و TAIR (https://www.arabidopsis.org/) دریافت شد. سپس توالی‌های دریافت شده از طریق روش tBLASTn در نرم‌افزار BioEdit (19) با E-value کمتر از 1E-10 جهت جستجوی ژن‌های AP2/ERF در توالی ژنوم مرجع گیاه آلوروپوس لیتورالیس موجود در پژوهشکدۀ ژنتیک و زیست‌فناوری کشاورزی طبرستان، مورد استفاده قرار گرفت. پس از حذف پروتئین‌های ناقص و تکراری، در نهایت، توالی‌های نواحی کدکننده یا CDS، پروتئینی و ژنومی این خانواده شناسایی شد. تأیید نهایی حضور دمین حفاظت شده AP2، با استفاده از پایگاه‌‌های اطلاعاتی InterProScan (https://www.ebi.ac.uk/interpro/search/sequence-search) (29)، Pfam (http://pfam.xfam.org/) (12) و SMART (http://smart.embl-heidelberg.de/) (34) انجام شد. در نهایت، توالی دمین‌های AP2 پروتئین‌های AP2/ERF شناسایی شده در آلوروپوس لیتورالیس با استفاده از پایگاه SMART به‌دست آمد و این توالی‌ها برای شناسایی ژن‌‌های DREB مورد تجزیه و تحلیل قرارگرفتند. وزن مولکولی و نقطه ایزوالکتریک پروتئین‌های DREB با استفاده از ابزار ProtParam از پایگاه اطلاعاتی ExPASy (https://web.expasy.org/protparam/) برآورد شد (14). بمنظور شناسایی جایگاه سلولی پروتئین‌ها از برنامه WoLF PSORT (https://wolfpsort.hgc.jp/)  استفاده شد (26).

تجزیه و تحلیل فیلوژنتیکی و هم‌ردیف‌سازی خانواده ژنی DREB در آلوروپوس لیتورالیس: جهت بررسی روابط تکاملی میان اعضای یک خانواده ژنی ابتدا بایستی تجزیه وتحلیل هم‌ردیف‌سازی صحیح صورت گیرد، سپس درخت فیلوژنتیکی با الگوریتم مناسب ترسیم شود. ابتدا هم‌ردیف‌سازی توالی‌های پروتئینی DREB به‌دست آمده از آلوروپوس با استفاده از نرم‌افزار ClustalW صورت گرفت (58). با استفاده از نتایج حاصل از هم‌ردیفی توالی‌های پروتئینی، درخت فیلوژنتیکی این توالی‌ها با استفاده از نرم‌افزار 6.0 MEGA (57) بر مبنای روش اتصال همسایه (NJ) با آزمون بوت‌استرپ (11) با تکرار 1000 ترسیم شد. همچنین درخت فیلوژنتیکی توالی‌های DREB1 و DREB2 آلوروپوس، آرابیدوپسیس، برنج و ذرت براساس هم‌ردیف‌سازی دمین کارکردی رسم شد.

تجزیه و تحلیل ساختار ژنی و شناسایی موتیف‌های حفاظت شده: از طریق مقایسه توالی‌های کدکننده‌ CDS و ژنومی مربوط به هر ژن، ساختار اگزون-اینترون ژن‌های DREB در آلوروپوس با استفاده از برنامۀ GSDS (http://gsds.cbi.pku.edu.cn/) ترسیم شد (27). بمنظور شناسایی موتیف‌های حفاظت‌شده در توالی‌های پروتئینی DREB آلوروپوس، از برنامه MEME (http://meme-suite.org/tools/meme/) استفاده شد (4). پارامترهای مورد استفاده شامل شناسایی حداکثر 15 موتیف، و کمترین و بیشترین طول موتیف‌ها بترتیب 6 و 50 اسیدآمینه بود. علاوه‌بر این، تمامی موتیف‌های شناسایی شده براساس پایگاه اطلاعاتی InterProScan مستندسازی شدند.

تنش شوری و بررسی الگوی بیان ژن‌های DREB در بافت‌های برگ و ریشه آلوروپوس: برای بررسی بیان ژن‌های DREB در بافت‌های برگ و ریشه آلوروپوس تحت تنش شوری، از داده‌هایRNA-seq  استفاده شد. ابتدا بر روی گیاهان دو ماهه، تنش شوری در غلظت 600 میلی‌مولار اعمال شد. سپس یک هفته پس از اعمال تنش شوری، نمونه‌برداری از دو بافت برگ و ریشه صورت گرفت. در ادامه، گیاهان باقیمانده به محیط هیدروپونیک فاقد نمک منتقل و یک هفته پس از انتقال به شرایط بازیابی، از بافت‌های برگ و ریشه نمونه‌برداری صورت پذیرفت. سپس، فرایند توالی‌یابی در دستگاه HiSeq 2500 شرکت Illumina انجام گرفت. آنالیز تفاوت بیان ژن‌ها به‌صورت Log2FC در شرایط تنش شوری و بازیابی با استفاده از نرم‌افزار CLC Genomics Workbench Version 6.5 (www.clcbio.com) بررسی شد. بدین ترتیب که پس از تشکیل ماتریس بیان ژن که حاوی ژن‌ها و سطح بیان آن‌ها بود، بیان ژن‌های کاندید، مورد بررسی قرار گرفت و در نهایت نتایج به‌دست آمده در نمودار Heatmap ترسیم شده توسط نرم‌افزار CIMminer (https://discover.nci.nih.gov/cimminer/home.do/) ارائه شد (54).

نتایج

شناسایی اعضای خانواده ژنی DREB در آلوروپوس لیتورالیس: جهت شناسایی ژن‌های DREB بالقوه در ژنوم آلوروپوس لیتورالیس، از الگوریتم tBLASTn توالی‌های پروتئینی خانوادۀAP2/ERF  آرابیدوپسیس و برنج با ژنوم آلوروپوس استفاده شد. بر این اساس پس از حذف توالی‌های تکراری، 67 توالی پروتئینی شناسایی شد. نتایج بررسی پروتئین‌ها در پایگاه‌های InterProScan،‌ Pfam و SMART مشخص کرد که تمام توالی‌های شناسایی شده دارای دمین AP2 هستند. سپس توالی دمین‌های AP2 پروتئین‌های شناسایی شده با استفاده از پایگاه SMART به‌دست آمد. با بررسی توالی دمین‌های AP2 و همولوژی با ژن‌های آرابیدوپسیس، 16 توالی کدکننده DREB بعنوان اعضای خانوادۀ DREB در گیاه آلوروپوس لیتورالیس شناسایی شدند. جهت نام‌گذاری ژن‌های DREB آلوروپوس، ابتدا پیشوند Al برگرفته از گیاه A. littoralis و سپس DREB و در نهایت شماره‌گذاری براساس گروه‌بندی ژن‎ها در درخت فیلوژنتیکی انجام گرفت. این شیوه نام‌گذاری بیشتر در مورد ژن‎های DREB ذرت و جو نیز استفاده شده است (17و 41). طول پروتئین‌های این خانواده از 159 (AlDREB5.3) تا 448 اسیدآمینه (AlDREB6.1) متغیر بود. وزن مولکولی آن‌ها نیز از 40/17 تا 48/48 کیلودالتون بود. شاخص ایزوالکتریک پروتئین‌های مورد مطالعه متغیر و در محدودۀ 91/4 در AlDREB5.2 تا 90/9 در AlDREB5.3 بود (جدول 1).

یکی از ویژگی‌های کلیدی در بررسی کارکرد پروتئین‌ها، مکان‌یابی سلولی است که می‌تواند در فعالیت سلولی مشارکت داشته باشد و بطور کارآمدی در انتخاب جایگاه درست سلولی عمل کند (64). مکان‌یابی پروتئین‌ها مشخص نمود که 14 پروتئین از 16 پروتئین DREB شناسایی شده در هسته و پروتئین‌هایAlDREB5.1 و AlDREB6.4 بترتیب در سیتوپلاسم و کلروپلاست، فعال هستند (جدول 1).

 

جدول 1- تعیین‌مشخصه ژن‌های DREB در ژنوم آلوروپوس لیتورالیس

نام ژن

شماره ژن

طول پروتئین

طول ژن

طول CDS

تعداد اگزون

تعداد اینترون

وزن مولکولی

نقطه ایزوالکتریک

جایگاه سلولی

 

AlDREB1.1

Alg12355

222

669

669

1

0

24.38

4.94

nucl: 10, mito: 2, chlo: 1, cysk: 1

AlDREB2.1

Alg655

253

762

762

1

0

28.03

6.45

nucl: 11, cyto: 2, vacu: 1

AlDREB2.2

Alg6392

390

2747

1173

4

3

43.07

4.96

nucl: 9, cyto: 4, chlo: 1

AlDREB2.3

Alg13463

253

1462

762

2

1

28.29

6.21

nucl: 13, plas: 1

AlDREB4.1

Alg2745

210

633

633

1

0

22.62

5.30

nucl: 14

AlDREB4.2

Alg9994

233

702

702

1

0

24.78

5.43

nucl: 13, cyto: 1

AlDREB4.3

Alg14808

259

780

780

1

0

2733

5.00

nucl: 13, cyto: 1

AlDREB5.1

Alg1100

212

639

639

1

0

22.85

5.26

cyto: 10, nucl: 2, chlo: 1, mito: 1

AlDREB5.2

Alg2574

228

687

687

1

0

24.10

4.91

nucl: 7, mito: 5, chlo: 1, extr: 1

AlDREB5.3

Alg10270

159

480

480

1

0

17.40

9.90

nucl: 11, mito: 2, cyto: 1

AlDREB5.4

Alg14923

237

714

714

1

0

24.38

5.20

nucl: 8, chlo: 3, extr: 3

AlDREB6.1

Alg3883

448

1347

1347

1

0

48.48

7.91

nucl: 14

AlDREB6.2

Alg6105

296

891

891

1

0

31.50

6.75

nucl: 9.5, nucl_plas: 5.5, mito: 2, chlo: 1, cyto: 1

AlDREB6.3

Alg8903

286

861

861

1

0

30.54

6.45

nucl: 13, cyto: 1

AlDREB6.4

Alg9431

279

840

840

1

0

30.53

9.05

chlo: 12, nucl: 2

AlDREB6.5

Alg12885

436

1311

1311

1

0

46.81

8.73

nucl: 14

اعداد نمایش داده شده در جایگاه سلولی؛ بر مبنای جایگاه‌های پیش‌بینی شده بر اساس مشابهت با جایگاه ژنی 14 ژن همولوگ بر مبنای الگوریتم Nearest Neighbors (نزدیکترین همسایه) می‌باشد.

 

تجزیه و تحلیل فیلوژنتیکی و هم‌ردیف‌سازی خانواده ژنی DREB در آلوروپوس لیتورالیس: بمنظور دسته‌بندی ژن‌های DREB شناسایی شده در آلوروپوس لیتورالیس، ابتدا هم‌ردیف‌سازی چندگانه توالی‌های پروتئینی ژن‌های DREB صورت گرفت، سپس درخت فیلوژنتیکی توالی‌های پروتئینی مربوطه بر مبنای روش اتصال همسایه (NJ) ترسیم شد. 16 ژن DREB آلوروپوس به 5 گروه A1، A2، A4، A5 و A6، تقسیم‌بندی شدند. به این ترتیب که یک ژن در گروه A1، 3 ژن در گروه A2، 3 ژن در گروه A4، 4 ژن در گروه A5، و 5 ژن در گروه A6 قرارگرفت (شکل 1) نام‌گذاری این گروه‌ها براساس همولوژی با آرابیدوپسیس، صورت گرفت.

تجزیه و تحلیل هم‌ردیف‌سازی نشان داد که پروتئین‌های DREB دارای همولوژی بالایی در دمین AP2/ERF و حاوی یک موتیف WLG حفاظت شده در دمین AP2/ERF آلوروپوس هستند (شکل 2). در پروتئین‌های کد شده توسط ژن‌های DREB، اسیدآمینه والین در موقعیت‌ 14 دمین AP2/ERF حفاظت‌شده است ولی گلوتامیک اسید در موقعیت 19 حفاظت شده نیست و در گروه A1، A5 و A6 بترتیب با والین، آلانین و لوسین جایگزین شده است. گروه A1، حاوی توالی آمینو اسیدی CEVR حفاظت شده بین V14 و V19 بود و این منطقه به یک توالی آمینو اسیدی AEIR در گروه A2 و A6 تبدیل شد. در گروه A4، سرین در موقعیت 15 دمین AP2/ERF برای اتصال اختصاصی عنصر ERE بسیار حیاتی است و آلانین یا سرین در موقعیت 15 دمین در گروه A5 بسیار مهم است (شکل 2).

علاوه‌براین، ژن‌های A1 (DREB1) و A2 (DREB2) در آرابیدوپسیس (52)، برنج (44و 45) و ذرت (41) شناسایی و دانلود شدند. سپس، درخت فیلوژنتیکی براساس هم‌ردیف‌سازی 55 توالی پروتئینی DREB1 و DREB2 آلوروپوس، آرابیدوپسیس، برنج و ذرت ترسیم شد (شکل 3). در نهایت، توپولوژی درخت، ژن‌های گروه DREB1 و DREB2 را در دو خوشه جداگانه قرار داد. گروه DREB1 در مجموع شامل 27 ژن بوده، که 10 10، 6 و 1 ژن بترتیب به ذرت، برنج، آرابیدوپسیس و آلوروپوس تعلق داشت. گروه DREB2 نیز در مجموع شامل 28 ژن بوده، که تعداد 10 6، 9 و 3 ژن بترتیب در ذرت، برنج، آرابیدوپسیس و آلوروپوس مشاهده شد (شکل 3).

 

 

شکل 1- آنالیز فیلوژنتیکی اعضای خانواده DREB در آلوروپوس لیتورالیس. هم‌ردیفی چندگانه پروتئین‌های DREB به‌دست آمده از آلوروپوس لیتورالیس با استفاده از نرم‌افزار ClustalW انجام و درخت فیلوژنتیکی به کمک نرم‌افزارMEGA 6.0  بر مبنای روش اتصال همسایه با آزمون بوت‌استرپ با تکرار 1000 ترسیم شد.

شکل 2- هم‌ردیف‌سازی دمین‌های AP2 پروتئین‌های DREB در آلوروپوس لیتورالیس. هم‌ردیفی چندگانه دمین‌های AP2 پروتئین‌های DREB به‌دست آمده از آلوروپوس لیتورالیس با استفاده از نرم‌افزار ClustalW انجام شد. ردیف‌هایی که به‌صورت کادر مشخص شده‌اند، اعضای هر گروه را نشان می‌دهند و ستون‌هایی مشخص شده به‌صورت کادر،  نشان‌دهنده آمینواسیدهای حفاظت‌شده می‌باشند.

 

شکل 3- درخت فیلوژنتیکی ژن‌های DREB1 و DREB2 در آلوروپوس، آرابیدوپسیس، ذرت و برنج. درخت فیلوژنتیکی بر اساس هم‌ردیف‌سازی 55 توالی پروتئینی کامل DREB1 و DREB2 در چهار گونه، ساخته شد. اسامی و شناسه ژن‌ها برای آلوروپوس به رنگ قرمز؛ برنج به رنگ بنفش؛ آرابیدوپسیس به رنگ آبی؛ و برای ذرت به رنگ سبز نشان داده شد. اسامی ژن‌ها برگرفته از اطلاعات منتشر شده در مطالعات قبلی است (41، 44،  45و 52). مقادیر بوت‌استرپ با تکرار 1000 روی هر گره نشان داده شد.

 

تجزیه و تحلیل ساختار ژنی و شناسایی موتیف‌های حفاظت شده: بررسی ساختار ژنی می‌تواند شواهد ارزشمندی جهت تأیید درخت فیلوژنتیکی و روابط تکاملی درون خانواده‌های ژنی ارائه کند. زیرا این نوع تنوع ساختاری فرایند مهمی در تکامل خانواده‌های ژنی به‌شمار می‌رود. در این تحقیق، با مقایسه ساختار اگزون-اینترون در توالی‌های کدکننده ژن‌های DREB آلوروپوس لیتورالیس، مشخص شد که بیشتر ژن‌ها (14 مورد از 16 ژن) هیچ اینترونی در نواحی کدکننده آن‌ها وجود نداشته و فقط ژن‌های AlDREB2.2 و AlDREB2.3 ‌بترتیب دارای3 و یک اینترون هستند (جدول 1). مشاهده شد که تنها ژن‌های گروه A2 دارای اینترون می‌باشند که نشان‌دهنده مسیر تکاملی متفاوت این ژن‌ها نسبت به سایر ژن‌ها است. در سطح DNA، بیشترین طول ژن (2747) متعلق به ژن AlDREB2.2 و کمترین طول ژن (633) متعلق به ژن AlDREB4.1 بود (جدول 1).

در این تحقیق 15 موتیف حفاظت‌شده با استفاده از نرم افزار MEME برای شناسایی موتیف‌های حفاظت شده در میان پروتئین‌های خانواده DREB مورد تجزیه و تحلیل قرارگرفت. تجزیه و تحلیل موتیف نشان داد که بسیاری از ژن‌های DREB آلوروپوس حاوی موتیف‌های 1، 2 و 3 بودند (شکل 4). با مستندسازی موتیف‌های شناسایی شده با استفاده از InterPro، موتیف‌های 1 و 2 بعنوان دمین AP2/ERF پیش‌بینی شدند. دمین CMIV (موتیف 4) بطور اختصاصی در گروه DREB A2 یافت شد (جدول 2). این نتایج نشان‌ داد که بیشتر اعضای مرتبط به هم در درخت فیلوژنتیکی، ترکیب موتیف مشترکی را با یکدیگر به اشتراک می‌گذارند که این امر می‌تواند بیانگر شباهت‌های عملکردی در میان پروتئین‌های DREB در همان زیرشاخه باشد.

 

 

 

شکل 4- موتیف‌های حفاظت‌شده پروتئین‌های DREB در آلوروپوس. موتیف‌های شناسایی شده با شماره‌های 1 تا 15 با رنگ‌های مختلف در پایین شکل، p- value و اسامی اعضای DREB در سمت چپ شکل نشان داده شده است.

 

 

جدول2- توالی‌ موتیف‌های شناسایی شده در ژن‌های DREB آلوروپوس توسط برنامهMEME .

موتیف

طول موتیف

توالی موتیف

1

30

RNRTRJWLGTFDTAEDAARAYDAAALALRG

2

22

QKLYRGVRQRSWGKWVAEIREP

3

7

ARLNFPD

4

21

RKAPAKGSKKGCMKGKGGPEN

5

33

VPEMQQLDFSEAPWDEAEGFALRKYPSLEIDWD

6

20

QQRQQMISFGGPQQQQQQQF

7

28

DEAWFSAWGPGSSLWDYDMDNARWLFLN

8

29

WKKRPRRKRDGPDSIAEVIKRWKZINQKL

9

7

HIFPFAY

10

16

QLLRYWSEALNLSPRG

11

13

LHAAVDAKLQAIC

12

6

RPLKKI

13

11

ETRHPVFRGVR

14

6

PKCMEL

15

6

LYQHLL

 

 

تنش شوری و بررسی الگوی بیان ژن‌های DREB در بافت‌های برگ و ریشه آلوروپوس: بمنظور درک بهتر کارکرد ژن‌های DREB در گیاه آلوروپوس، الگوی بیان آن‌ها در دو بافت برگ و ریشه، در شرایط تنش شوری و بازیابی با استفاده از داده‌های RNA-seq مورد بررسی قرار گرفت. با استفاده از داده‌های ترانسکریپتوم آلوروپوس، یک نمودار Heatmap در مقیاس log2FC ترسیم شد. همان‌گونه که در نمودار Heatmap (شکل 5) نشان داده شده است، الگوی متفاوتی از بیان ژن در ژن‌های DREB مشاهده شد. این الگوی بیان متفاوت با توجه به وجود دمین‌های مشابه، می‌تواند بدلیل وجود عملکردهای مولکولی متفاوت و نیز مکانیسم‌های تنظیمی مختلف در کنترل فعالیت این ژن‌ها باشد.

باتوجه به نتایج به‌دست آمده از آنالیز ترانسکریپتوم، ژن‌های AlDREB6.4 و AlDREB5.4 فاقد بیان در بافت ریشه بودند که حاکی از بیان اختصاصی این ژن‌ها در بافت برگ می‌باشد. ژن AlDREB6.3 با مقدار بیان 16/1، در شرایط تنش شوری در بافت ریشه (بیان 2/2 برابری نسبت به شاهد)، بیشترین بیان را داشت. بعد از آن ژن AlDREB6.2 دارای بیشترین مقدار بیان (83/0)، در شرایط تنش شوری در بافت ریشه بود.

بیشترین کاهش بیان نیز در ژن AlDREB6.4 (با مقدار بیان 43/2-)، در شرایط بازیابی در بافت برگی (4/5 کاهش بیان نسبت به شاهد) مشاهده شد و بعد از آن بیشترین کاهش بیان به ژن AlDREB6.3 (03/2-) نیز در شرایط بازیابی در بافت برگی تعلق داشت. بنابراین، نتایج تحقیق حاضر نشان داد که عوامل رونویسی AlDREB بعنوان فعال‌کننده‌های مهم رونویسی عمل می‌کنند و می‌توانند در بهبود تحمل گیاه در برابر تنش‌ شوری مفید باشند.

بحث و نتیجه گیری

بررسی منابع نشان می‌دهد که خانواده ژنی DREB در گونه‌هایی مانند برنج، گوجه‌فرنگی، سویا، گندم، جو و ذرت نقش مهمی در پاسخ‌های گیاه به تنش‌های محیطی ایفا می‌نمایند (3و 46). بنابراین، در این بررسی برای اولین بار، یک تجزیه و تحلیل جامع از طبقه‌بندی، ساختار ژنی، ترکیب موتیف‌ها و بیان خانواده DREB در گیاه آلوروپوس لیتورالیس ‌بعنوان یک گیاه تک‌لپه از خانواده گندمیان ارائه شد. در مجموع 16 ژن AlDREB شناسایی شد که در 5 گروه A1، A2، A4، A5 و A6 طبقه‌بندی شدند. ژن‌های DREB در جو نیز در 5 گروه A1، A2، A4، A5 و A6، طبقه‌بندی شده‌اند (17).

 

 

شکل 5- پروفایل بیانی ژن‌های DREB آلوروپوس لیتورالیس بر اساس داده‌های RNA-seq. نمایش Heatmap، میزان تغییر بیان ژن‌های DREB آلوروپوس را در دو بافت برگ و ریشه تحت شرایط تنش شوری و ریکاوری نشان می‌دهد. ارزش نسبی سیگنال به‌صورت نوار رنگی در انتهای Heatmap ارائه شده است که در آن رنگ سبز نشان‌دهنده کاهش بیان، رنگ سیاه نشان‌دهنده عدم تغییر بیان و رنگ قرمز نشان‌دهنده افزایش بیان است.

 

لازم بذکر است تعداد ژن‌های DREB در گیاهان آرابیدوپسیس، جو، ذرت و ارزن ایتالیایی بترتیب 56، 41، 65 و 48 گزارش شده است (17، 33، 41و 52).

پروتئین‌های DREB اعضای مهم خانواده عوامل رونویسی AP2/ERF هستند. ناحیه اتصال به DNA این پروتئین‌ها بطور خاص عنصر DRE در منطقه پروموتور ژن‌های پاسخ‌دهنده به تنش را تشخیص می‌دهد و منطقه ترانس‌اکتیویسیون (Transactivation) (فعال‌سازی ترانس)، با فعال‌سازی بیان ژن‌های پاسخ‌دهنده به تنش، مسیرهای سیگنالینگ را در پاسخ به تنش گیاهان فعال می‌کند (40). مطالعه حاضر نشان داد که در پروتئین‌های DREB، اسیدآمینه والین در موقعیت‌ 14 دمین AP2/ERF حفاظت‌شده است ولی گلوتامیک اسید در موقعیت 19 حفاظت شده نیست و در گروه A1، A5 و A6 بترتیب با والین، آلانین و لوسین جایگزین شده است. برخی مطالعات نشان داده‌اند که دو آمینواسید کارکردی حفاظت شده (والین و گلوتامیک اسید) بترتیب در موقعیت‌های 14 و 19 در دمین اتصال به DNA وجود دارند و بنظر می‌رسد که جایگاه‌های مهمی برای اتصال پروتئین‌های DREB به توالی‌های سیس DRE هستند. پروتئین‌های DREB1A برای اختصاصیت اتصال به DNA، دارای والین در موقعیت 14، و DREB2A نیز دارای والین و گلوتامیک اسید در موقعیت‌های 14 و 19 می‌باشند (52). با این حال، مطالعات اخیر نشان داده‌اند که گلوتامیک اسید 19 در پروتئین DREB1 در برنج و جو حفاظت‌شده نبوده و به جای آن، والین جایگزین شده است (7). در بیشتر پروتئین‌های نوع OsDREB1، به استثنای OsDREB1C، والین در هر دو موقعیت 14 و 19، یافت می‌شود. سایر پروتئین‌های نوع DREB1 در گیاهان تک‌لپه (مانند جو، گندم و چاودار) نیز دارای والین در موقعیت 19 هستند (3). این مشاهدات نشان می‌دهند که عملکرد آمینواسید 14 برای فعالیت اختصاصی اتصال به DNA می‌تواند مهمتر از آمینواسید 19 باشد. علاوه‌بر این دو اسیدآمینه، وجود آلانین حفاظت‌شده در موقعیت 37 دمینERF/AP2 نیز در اتصال به عناصر DRE ضروری است (42).

اکثر آمینواسید‌ها در دمین انتهای آمینی، حفاظت شده هستند. سیگنال متمرکزکنندة هسته‌ای (NLS) "PKRPAGRTKFRETRHP"، با عنوان موتیف DSAW بلافاصله در کنار دمینERF/AP2 قرار داشته و یک موتیف LWSY محافظت شده در انتهای کربوکسیلی بیشتر پروتئین‌های DREB1 موجود است (6) که این امر در مورد توالی AlDREB1.1 آلوروپوس نیز صدق می‌کند.

بررسی ساختار ژنی خانواده DREB نشان داد که 5/87 درصد از ژن‌های AlDREB فاقد اینترون می‌باشند. همچنین مشخص شده است که 88 درصد از ژن‌های DREB در Populus trichocarpa فاقد اینترون در نواحی کدکننده خود می‌باشند (5). فقدان اینترون در بیشتر ژن‌های عوامل رونویسی AP2/ERF گیاهی از فرضیه انتقال جانبی ژن از مبدأ باکتری‌ها یا ویروس‌ها حمایت می‌کند (43).

دمین‌ها و موتیف‌های عوامل رونویسی اغلب با برهم‌کنش پروتئین، فعالیت رونویسی و اتصال به DNA پروتئین مرتبط می‌باشند (38و 39). تجزیه و تحلیل موتیف‌ها نشان داد که موتیف‌های 1 و 2 بعنوان دمین AP2/ERF پیش‌بینی شدند. دمین AP2/ERF دارای سه صفحه بتا و یک مارپیچ آلفا در انتهای آمینی خود هستند (60). دمین CMIV (موتیف 4) بطور اختصاصی در گروه A2 یافت شد. هم‌ردیف‌سازی توالی‌های آمینواسیدی گروه DREB A2 آرابیدوپسیس در ناحیه انتهای آمینی شامل موتیف حفاظت شده CMIV-1 و دمین اتصال به DNA بود (47). این نتایج نشان‌ داد که بیشتر اعضای مرتبط به هم در درخت فیلوژنتیکی، ترکیب موتیف مشترکی را با یکدیگر به اشتراک می‌گذارند، که این امر می‌تواند بیانگر شباهت‌های عملکردی در میان پروتئین‌های DREB در همان زیرشاخه باشد.

تجزیه و تحلیل پروفایل بیانی خانواده ژنی می‌تواند اطلاعات مهمی در مورد عملکرد آن‌ها فراهم آورد (44). علی‌رغم حساسیت بالا و توالی اختصاصی (Sequence specific) بودن تکنیک qPCR در کنار اعتبار بالای نتایج حاصله؛ تکنیک RNA-seq ضمن ارائه همزمان توالی و کمیت ژن هدف از اختصاصیت و حساسیت بالایی در شناسایی ایزوفرم‌های مختلف یک ژن برخوردار است. ضمن اینکه امکان ارائه اطلاعات بیانی تمام ژن‎‌ها را در قالب یک آزمایش فراهم می‌نماید (10و 59). باتوجه به عدم تحقیقات پیشین در بررسی بیان خانواده ژنی DREB در گیاه آلوروپوس و همچنین همسانی (Identity) بالای اعضای این خانواده ژنی، در این تحقیق از مزیت روش RNA-seq جهت شناسایی ژن‌های فعال و غیرفعال این خانواده استفاده گردید. اطلاعات حاصله در این بخش جهت غربال تمام اعضای این خانواده ژنی در سطح ترانسکریپتوم بمنظور شناسایی ژن‌هایی با بیشترین و کمترین بیان و ژن‌هایی با بیان بافت-اختصاصی مورد استفاده قرارگرفت. الگوی بیان ژن‌های AlDREB نشان‌دهنده اهمیت نقش آن‌ها در پاسخ گیاه به تنش‌ شوری است. ژن‌های AlDREB6.3 و AlDREB6.2 بیشترین بیان را در شرایط تنش شوری در بافت ریشه به نمایش گذاشتند. ژن AlDREB6.2 با ژن RAP2.4 (At1g78080) در آرابیدوپسیس همولوگ است. در مطالعه دیگری مشخص شده است که ژن RAP2.4 در پاسخ به خشکی، شوری بالا و گرما بیان می‌شود (37و 51). بیش‌بیان یا جهش در ژن‌های RAP2.4 و RAP2.4B در آرابیدوپسیس مشخص کرد که این ژن‎‌ها در پایین‌دست یک نقطة مشترک برای مسیرهای پیام‌رسان نور و اتیلن عمل می‌کنند که بطور هماهنگ چندین فرایند تکاملی و پاسخ به تنش را تنظیم می‌کنند (37). قابل توجه است که در لاین‌های با بیش‌بیان RAP2.4 و RAP2.4B، بیان چندین ژن دیگر مرتبط با انتقال لیپید نیز تغییر یافته است که بیانگر ارتباط بین عوامل رونویسی DREB و تغییرات سازگاری در متابولیسم لیپید است (51).

در این بررسی بیشترین کاهش بیان نیز در ژن‌های AlDREB6.4 و AlDREB6.3 در شرایط بازیابی در بافت برگی مشاهده شد. در بررسی دیگری، بیان ژن‌های AtDREB2A و AhDREB1 در ریشه‌ها، ساقه‌ها و برگ‌ها در شرایط رشد طبیعی مشاهده شد. در شرایط تنش شوری، AhDREB1 در ریشه‌ها بیشتر بیان شد، اما در ساقه‌ها و برگ‌ها با سطوح پایین‌تری بیان شد (55). رونویسی ژن GmDREBa/b در برگ‌های سویا در تنش‌های سرما، شوری و خشکی القاء شد. در ریشه‌ها، بیان ژن GmDREBc در تیمارهای شوری، خشکی و ABA به‌صورت افزایش بیان مشاهده شد، اما تحت تأثیر تیمار سرما نبود (35). برخی مطالعات نشان داده‌اند که ژنHARDY  (At2g36450) متعلق به زیرگروه A4 است. بیش‌بیان این ژن با بهبود کارآیی استفاده از آب، موجب مقاومت به خشکی در برنج شد. این ژن HRD همولوگ ژن AlDREB4.1 در این مطالعه است. در بررسی چن و همکاران (5)، ژن‌های PtrDREB4 و PtrDREB28 متعلق به زیرگروه A2 توسط تنش‌های ABA، شوری و خشکی القاء شدند. علاوه‌بر این، ژن‌های PtrDREB51، PtrDREB55 و PtrDREB68 متعلق به زیرگروه A4 در تنش‌های شوری و خشکی بیان شدند.

نتایج تحقیق حاضر نشان داد که عوامل رونویسی AlDREB احتمالاً بعنوان فعال‌کننده‌های مهم رونویسی عمل می‌کنند و می‌توانند در بهبود تحمل گیاه در برابر تنش‌های غیرزیستی، مفید باشند. این مشاهدات می‌توانند پایه‌ای برای تجزیه و تحلیل کارکردی ژن‌هایDREB  آلوروپوس برای درک نقش‌های زیستی آن‌ها فراهم آورد.

سپاسگزاری

این پژوهش با حمایت مالی پژوهشکده ژنتیک و زیست‌فناوری کشاورزی طبرستان، دانشگاه علوم کشاورزی و منابع طبیعی ساری در قالب طرح تحقیقاتی مصوب به شمارهT234/96  انجام شده است و بدینوسیله نویسندگان بر خود لازم می‌دانند مراتب تشکر صمیمانه خود را اعلام نمایند.

1- بنده حق، ع.، علیپور قربانی، ش.، تورچی، م.، و شکری قره لو، و. ر.، 1397. تجزیه پروتئوم بذر کلزا تحت تنش شوری، مجله پژوهشهای گیاهی (مجله زیست‌شناسی ایران)، جلد 31، شماره 2، صفحات 433-422.
2- دشتبانی، ف.، حاجی بلند، ر.، و علی اصغرزاد، و. ن.، 1396. جوانه‌زنی، فتوسنتز و رشد دو گونه هالوفیت پوکسنلیا دیستانس و آلوروپوس لیتورالیس تحت شرایط شوری و همزیستی آن‌ها با قارچ‌های میکوریز آربوسکول‌دار در شرایط طبیعی زیستگاه در دشت تبریز، مجله پژوهشهای گیاهی (مجله زیست‌شناسی ایران)، جلد 30، شماره 4، صفحات 833-817.
 
3- Agarwal, P. K., Agarwal, P., Reddy, M., and Sopory, S. K., 2006. Role of DREB transcription factors in abiotic and biotic stress tolerance in plants. Plant Cell Reports, 25(12), PP: 1263-1274.
4- Bailey, T. L., Boden, M., Buske, F. A., Frith, M., Grant, C. E., Clementi, L., Ren, J., Li, W. W., and Noble, W. S., 2009. MEME SUITE: tools for motif discovery and searching, Nucleic Acids Research, 37, PP: 202-208.
5- Chen, Y., Yang, J., Wang, Z., Zhang, H., Mao, X., and Li, C., 2013. Gene structures, classification, and expression models of the DREB transcription factor subfamily in Populus trichocarpa, The Scientific World Journal, 2013, PP: 1-13.
6- Cong, L., Chai, T. Y., and Zhang, Y. X., 2008. Characterization of the novel gene BjDREB1B encoding a DRE-binding transcription factor from Brassica juncea L. Biochemical and Biophysical Research Communications, 371(4), PP: 702-706.
7- Dubouzet, J. G., Sakuma, Y., Ito, Y., Kasuga, M., Dubouzet, E. G., Miura, S., Seki, M., Shinozaki K., and Yamaguchi‐Shinozaki, K., 2003. OsDREB genes in rice, Oryza sativa L., encode transcription activators that function in drought‐, high‐salt‐and cold‐responsive gene expression, The Plant Journal, 33(4), PP: 751-763.
8- Egawa, C., Kobayashi, F., Ishibashi, M., Nakamura, T., Nakamura, C., and Takumi, S., 2006. Differential regulation of transcript accumulation and alternative splicing of a DREB2 homolog under abiotic stress conditions in common wheat. Genes & Genetic Systems, 81(2), PP: 77-91.
9- Faraji, S., Najafi-Zarrini, H., Hashemi-Petroudi, S., and Ranjbar, G., 2017. AlGLYI gene implicated in salt stress response from halophyte Aeluropus littoralis, Russian Journal of Plant Physiology, 64(6), PP: 850-860.
10- Fassbinder-Orth, C. A., 2014. Methods for quantifying gene expression in ecoimmunology: from Qpcr to RNA-Seq. Integrative and Comparative Biology, 54(3), PP: 396–406.
11- Felsenstein, J., 1985. Confidence limits on phylogenies, an approach using the bootstrap. Evolution, 39(4), PP: 783-791.
12- Finn, R. D., Coggill, P., Eberhardt, R. Y., Eddy, S. R., Mistry, J., Mitchell, A. L., Potter, S. C., Punta, M., Qureshi, M., and Sangrador-Vegas, A., 2015. The Pfam protein Families database: towards a more sustainable future. Nucleic Acids Research, 44, PP: 279-285.
13- Fujita, Y., Fujita, M., Shinozaki, K., and Yamaguchi-Shinozaki, K., 2011. ABA-mediated transcriptional regulation in response to osmotic stress in plants, Journal of plant research, 124(4), PP: 509-525.
14- Gasteiger, E., Hoogland, C., Gattiker, A., Wilkins, M. R., Appel, R. D., and Bairoch, A., 2005. Protein identification and analysis tools on the ExPASy server. In: J. M., Walker (ed.) The proteomics protocols handbook, PP: 571-607. Humana Press, New York City, New York, United States.
15- Ghorbani, H. R., Samizadeh Lahiji, H., and Nematzadeh, G. A., 2017. Expression pattern analysis of transcription factors from Aeluropus littoralis in response to salt stress and recovery condition, Journal of Plant Molecular Breeding, 5(1), PP: 19-30.
16- Ghorbani, H. R., Samizadeh Lahiji, H., and Nematzadeh, G. A., 2019. In silico characterization of proteins containing ARID-PHD domain and its expression in Aeluropus littoralis halophyte, Journal of Crop Breeding, 11(29), PP: 143-152.
17- Guo, B., Wei, Y., Xu, R., Lin, S., Luan, H., Lv, C., Zhang, X., Song, X., and Xu, R., 2016. Genome-wide analysis of APETALA2/ethylene-responsive factor (AP2/ERF) gene family in barley (Hordeum vulgare L.), Plos One, 11(9), e0161322 p.
18- Haake, V., Cook, D., Riechmann, J., Pineda, O., Thomashow, M. F., and Zhang, J. Z., 2002. Transcription factor CBF4 is a regulator of drought adaptation in Arabidopsis, Plant physiology, 130(2), PP: 639-648.
19- Hall, T. A., 1999. BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT, Nucleic Acids Symposium Series, 41, PP: 95-98.
20- Hashemi-Petroudi, S. H., Ghorbani, H., and Kuhlmann, M., 2018. Isolation Phosphoglycerate Dehydrogenase gene from Aeluropus littoralis halophyte plant and functional analysis of T-DNA mutant in Arabidopsis thaliana, Crop bitechnology, 8(23), PP: 79-92.
21- Hashemi-Petroudi, S. H., Nematzadeh, G. A., Askari, H., and Ghahary, S., 2014. Involvement of Cytosine DNA methylation in different developmental stages of Aeluropus littoralis. Journal of Plant Molecular Breeding, 2(2), PP: 56-67.
22- Hashemi-Petroudi, S. H., Nematzadeh, G. A., Askari, H., and Ghasemi, Y., 2012. Pattern of DNA cytosine methylation in Aeluropus littoralis during temperature stress, Journal of Plant Molecular Breeding, 1(1), PP: 16-24.
23- Hashemi-Petroudi, S. H., Nematzadeh, G. A., and M., Kuhlmann., 2019. Identification and analysis of a DEVIL paralog gene cluster in Aeluropus littoralis by comparative genomic approach Crop bitechnology, 9(25), PP: 79-92.
24- Hashemipetroudi, S., Nematzadeh, G., Ahmadian, G., Yamchi, A., and Kuhlmann, M., 2016. Expression analysis of salt stress related expressed sequence tags (ESTs) from Aeluropus littoralis by quantitative real-time PCR. Bioscience Biotechnology Research Communications, 9(3), PP: 445-456.
25- Hong, J. P., and Kim, W. T., 2005. Isolation and functional characterization of the Ca-DREBLP1 gene encoding a dehydration-responsive element binding-factor-like protein 1 in hot pepper (Capsicum annuum L. cv. Pukang), Planta, 220(6), PP: 875-888.
26- Horton, P., Park, K. J., Obayashi, T., Fujita, N., Harada, H., Adams-Collier, C., and Nakai, K., 2007. WoLF PSORT: protein localization predictor. Nucleic acids research, 35, PP: 585-587.
27- Hu, B., Jin, J., Guo, A.Y., Zhang, H., Luo, J., and Gao, G., 2014. GSDS 2.0, an upgraded gene feature visualization server, Bioinformatics, 31(8), PP: 1296-1297.
28- Ito, Y., Katsura, K., Maruyama, K., Taji, T., Kobayashi, M., Seki, M., Shinozaki, K., and Yamaguchi-Shinozaki, K, 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant and Cell Physiology, 47(1), PP: 141-153.
29- Jones, P., Binns, D., Chang, H. Y., Fraser, M., Li, W., McAnulla, C., McWilliam, H., Maslen, J., Mitchell, A., and Nuka, G., 2014. InterProScan 5: genome-scale protein function classification. Bioinformatics, 30(9), PP: 1236-1240.
30- Kaleybar Shahin, B., Nematzadeh, G., Hashemi, S. H. R., Askari, H., and Kabirnataj, S., 2013. Physiological and Genetic Responses of Halophyte Aeluropus Littoralis to Salinity. Journal of Crop Breeding, 5(12), PP: 15-29.
31- Kasuga, M., Liu, Q., Miura, S., Yamaguchi-Shinozaki, K., and Shinozaki, K., 1999. Improving plant drought, salt, and freezing tolerance by gene transfer of a single stress-inducible transcription factor. Nature biotechnology, 17(3), PP: 287-291.
32- Kim, J. S., Mizoi, J., Yoshida, T., Fujita, Y., Nakajima, J., Ohori, T., Todaka, D., Nakashima, K., Hirayama, T., and Shinozaki, K., 2011. An ABRE promoter sequence is involved in osmotic stress-responsive expression of the DREB2A gene, which encodes a transcription factor regulating drought-inducible genes in Arabidopsis. Plant and Cell Physiology, 52, (12), PP: 2136-2146.
33- Lata, C., Mishra, A. K., Muthamilarasan, M., Bonthala, V. S., Khan, Y., and Prasad, M., 2014. Genome-wide investigation and expression profiling of AP2/ERF transcription factor superfamily in foxtail millet (Setaria italica L.). PLoS One, 9(11), e113092 p.
34- Letunic, I., Doerks, T., and Bork, P., 2014. SMART, recent updates, new developments and status in 2015. Nucleic acids research, 43(D1), PP: D257-D260.
35- Li, X. P., Tian, A. G., Luo, G. Z., Gong, Z. Z., Zhang, J. S., and Chen, S. Y., 2005. Soybean DRE-binding transcription factors that are responsive to abiotic stresses. Theoretical and Applied Genetics, 110(8), PP: 1355-1362.
36- Lim, C. J., Hwang, J. E., Chen, H., Hong, J. K., Yang, K. A., Choi, M. S., Lee, K. O., Chung, W. S., Lee S. Y., and Lim, C. O., 2007. Over-expression of the Arabidopsis DRE/CRT-binding transcription factor DREB2C enhances thermotolerance. Biochemical and biophysical research communications, 362(2), PP: 431-436.
37- Lin, R. C., Park, H. J., and Wang, H. Y., 2008. Role of Arabidopsis RAP2, 4 in regulating light-and ethylene-mediated developmental processes and drought stress tolerance, Molecular plant, 1(1), PP: 42-57.
38- Liu, L., White, M. J., and MacRae, T. H., 1999. Transcription factors and their genes in higher plants: functional domains, evolution and regulation, European Journal of Biochemistry, 262(2), PP: 247-257.
39- Liu, M., Sun, W., Ma, Z., Zheng, T., Huang, L., Wu, Q., Zhao, G., Tang, Z., Bu, T., and Li, C., 2019. Genome-wide investigation of the AP2/ERF gene family in tartary buckwheat (Fagopyum Tataricum), BMC plant biology, 19(1), 84 p.
40- Liu, Q., Kasuga, M., Sakuma, Y., Abe, H., Miura, S., Yamaguchi-Shinozaki, K., and Shinozaki, K., 1998. Two transcription factors, DREB1 and DREB2, with an EREBP/AP2 DNA binding domain separate two cellular signal transduction pathways in drought-and low-temperature-responsive gene expression, respectively, in Arabidopsis. The Plant Cell, 10(8), PP: 1391-1406.
41- Liu, S., Wang, X., Wang, H., Xin, H., Yang, X., Yan, J., Li, J., Tran, L. S. P., Shinozaki, K., and Yamaguchi-Shinozaki, K., 2013. Genome-wide analysis of ZmDREB genes and their association with natural variation in drought tolerance at seedling stage of Zea mays L. PLoS genetics, 9(9), e1003790 p.
42- Liu, Y., Zhao, T. J., Liu, J. M., Liu, W. Q., Liu, Q., Yan, Y. B., and Zhou, H. M., 2006. The conserved Ala37 in the ERF/AP2 domain is essential for binding with the DRE element and the GCC box. FEBS letters, 580(5), PP: 1303-1308.
43- Magnani, E., Sjölander, K., and Hake, S., 2004. From endonucleases to transcription factors, evolution of the AP2 DNA binding domain in plants. The Plant Cell, 16(9), PP: 2265-2277.
44- Mao, D., and Chen, C., 2012. Colinearity and similar expression pattern of rice DREB1s reveal their functional conservation in the cold-responsive pathway. PloS one, 7(10), e47275 p.
45- Matsukura, S., Mizoi, J., Yoshida, T., Todaka, D., Ito, Y., Maruyama, K., Shinozaki, K., and Yamaguchi-Shinozaki, K., 2010. Comprehensive analysis of rice DREB2-type genes that encode transcription factors involved in the expression of abiotic stress-responsive genes, Molecular Genetics and Genomics, 283(2), PP: 185-196.
46- Mizoi, J., Shinozaki, K., and Yamaguchi-Shinozaki, K., 2012. AP2/ERF family transcription factors in plant abiotic stress responses. Biochimica et Biophysica Acta (BBA)-Gene Regulatory Mechanisms, 1819(2), PP: 86-96.
47- Nakano, T., Suzuki, K., Fujimura, T., and Shinshi, H., 2006. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant physiology, 140(2), PP: 411-432.
48- Qin, F., Kakimoto, M., Sakuma, Y., Maruyama, K., Osakabe, Y., Tran, L. S. P., Shinozaki, K., and Yamaguchi‐Shinozaki, K., 2007. Regulation and functional analysis of ZmDREB2A in response to drought and heat stresses in Zea mays L., The Plant Journal, 50(1), PP: 54-69.
49- Qin, F., Sakuma, Y., Li, J., Liu, Q.,. Li, Y. Q., Shinozaki, K., and Yamaguchi-Shinozaki, K., 2004. Cloning and functional analysis of a novel DREB1/CBF transcription factor involved in cold-responsive gene expression in Zea mays L., Plant and Cell Physiology, 45(8), PP: 1042-1052.
50- Qin, F., Sakuma, Y., Tran, L. S. P., Maruyama, K., Kidokoro, S., Fujita, Y., Fujita, M., Umezawa, T., Sawano, Y., and Miyazono, K. i., 2008. Arabidopsis DREB2A-interacting proteins function as RING E3 ligases and negatively regulate plant drought stress–responsive gene expression, The plant cell, 20(6), PP: 1693-1707.
51- Rae, L., Lao, N. T., and Kavanagh, T. A., 2011. Regulation of multiple aquaporin genes in Arabidopsis by a pair of recently duplicated DREB transcription factors, Planta, 234(3), PP: 429-444.
52- Sakuma, Y., Liu, Q., Dubouzet, J. G., Abe, H., Shinozaki, K., and Yamaguchi-Shinozaki, K., 2002. DNA-binding specificity of the ERF/AP2 domain of Arabidopsis DREBs, transcription factors involved in dehydration-and cold-inducible gene expression. Biochemical and biophysical research communications, 290(3), PP: 998-1009.
53- Sakuma, Y., Maruyama, K., Osakabe, Y., Qin, F., Seki, M., Shinozaki, K., and Yamaguchi-Shinozaki, K., 2006. Functional analysis of an Arabidopsis transcription factor, DREB2A, involved in drought-responsive gene expression. The Plant Cell, 18(5), PP: 1292-1309.
54- Scherf, U., Ross, D. T., Waltham, M., Smith, L. H., Lee, J. K., Tanabe, L., Kohn, K. W., Reinhold, W. C., Myers, T. G., and Andrews, D. T., 2000. A gene expression database for the molecular pharmacology of cancer, Nature genetics, 24(3), 236 p.
55- Shen, Y. G., Zhang, W. K., He, S. J., Zhang, J. S., Liu, Q., and Chen, S. Y., 2003. An EREBP/AP2-type protein in Triticum aestivum was a DRE-binding transcription factor induced by cold, dehydration and ABA stress, Theoretical and Applied Genetics, 106(5), PP: 923-930.
56- Stockinger, E. J., Gilmour, S. J., and Thomashow, M. F., 1997. Arabidopsis thaliana CBF1 encodes an AP2 domain-containing transcriptional activator that binds to the C-repeat/DRE, a cis-acting DNA regulatory element that stimulates transcription in response to low temperature and water deficit. Proceedings of the National Academy of Sciences, 94(3), PP: 1035-1040.
57- Tamura, K., Stecher, G., Peterson, D., Filipski, A., and Kumar, S., 2013. MEGA6, molecular evolutionary genetics analysis version 6.0. Molecular biology and evolution, 30(12), PP: 2725-2729.
58- Thompson, J. D., Gibson, T. J., and Higgins, D. G., 2003. Multiple sequence alignment using ClustalW and ClustalX, Current protocols in bioinformatics, 1, PP: 2-3.
59- VanGuilder, H. D., Vrana K. E., and Freeman, W. M., 2008. Twenty-five years of quantitative PCR for gene expression analysis, Biotechniques, 44(5), PP: 619-626.
60- Wang, X., Chen, X., Liu, Y., Gao, H., Wang, Z., and Sun, G., 2011. CkDREB gene in Caragana korshinskii is involved in the regulation of stress response to multiple abiotic stresses as an AP2/EREBP transcription factor, Molecular biology reports, 38(4), PP: 2801-2811.
61- Wessler, S. R., 2005. Homing into the origin of the AP2 DNA binding domain, Trends in plant science, 10(2), PP: 54-56.
62- Xue, G. P., and Loveridge, C. W., 2004. HvDRF1 is involved in abscisic acid‐mediated gene regulation in barley and produces two forms of AP2 transcriptional activators, interacting preferably with a CT‐rich element. The Plant Journal, 37(3), PP: 326-339.
63- Yamaguchi-Shinozaki, K., and Shinozaki, K., 1994. A novel cis-acting element in an Arabidopsis gene is involved in responsiveness to drought, low-temperature, or high-salt stress. The Plant Cell, 6(2), PP: 251-264.
64- Zhang, S., Xia, X., Shen, J., Zhou, Y., and Sun, Z., 2008. DBMLoc, a Database of proteins with multiple subcellular localizations, BMC bioinformatics, 9(1), 127 p.
65- Zouari, N., Saad, R. B., Legavre, T., Azaza, J., Sabau, X., Jaoua, M., Masmoudi, K., and Hassairi, A., 2007. Identification and sequencing of ESTs from the halophyte grass Aeluropus littoralis, Gene, 404(1), PP: 61-69.